Recombinant Human High Mobility Group Protein B2/HMGB2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEEVDHHHHHH |
Source: Human Cells.
MW :25.07kD.
Recombinant Human High Mobility Group Protein B2 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu209 is expressed with a 6His tag at the C-terminus. High Mobility Group Protein B2 (HMGB2) belongs to the non-histone chromosomal high-mobility group protein family. Members of this family are chromatin-associated and widely spread in the nucleus of higher eukaryotic cells. HMGB2 contains 2 HMG box DNA-binding domains. It is associated with chromatin and has the ability to bend DNA, preferentially single-stranded DNA. It is shown that HMGB2 is able to efficiently bend DNA and form DNA circles. In addition, HMGB2 is involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
MW :25.07kD.
Recombinant Human High Mobility Group Protein B2 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu209 is expressed with a 6His tag at the C-terminus. High Mobility Group Protein B2 (HMGB2) belongs to the non-histone chromosomal high-mobility group protein family. Members of this family are chromatin-associated and widely spread in the nucleus of higher eukaryotic cells. HMGB2 contains 2 HMG box DNA-binding domains. It is associated with chromatin and has the ability to bend DNA, preferentially single-stranded DNA. It is shown that HMGB2 is able to efficiently bend DNA and form DNA circles. In addition, HMGB2 is involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Chromosome, Cytoplasm, Secreted |
| Post transnational modification: | Acetylation enhances nucleosome binding and chromation remodeling activity. |
| Tissue Specificity: | Expressed in gastric and intestinal tissues (at protein level). |
| BioGrid: | 109391. 51 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
