Recombinant Human High Mobility Group Protein B1/HMGB1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDEVDHHHHHH |
Source: Human Cells.
MW :25.93kD.
Recombinant Human High Mobility Group Protein B1 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu215 is expressed with a 6His tag at the C-terminus. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.
MW :25.93kD.
Recombinant Human High Mobility Group Protein B1 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu215 is expressed with a 6His tag at the C-terminus. High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Chromosome, Cytoplasm, Secreted, Cell membrane, Endosome, Endoplasmic reticulum-Golgi intermediate compartment |
| Post transnational modification: | In vitro cleavage by CASP1 is liberating a HMG box 1-containing peptide which may mediate immunogenic activity; the peptide antagonizes apoptosis-induced immune tolerance (PubMed:24474694). Can be proteolytically cleaved by a thrombin:thrombomodulin complex; reduces binding to heparin and proinflammatory activities (By similarity). |
| Tissue Specificity: | Ubiquituous. Expressed in platelets (PubMed:11154118). |
| BioGrid: | 109389. 98 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
