-->

Recombinant Human Group XVI Phospholipase A1/A2/PLA2G16 (N-6His)

Product code: 32-8103

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $371.00 

  • $565.00 

-->

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com


Amount : 50 µg
Content : Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, pH 8.0.
Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
AA sequence : MGSSHHHHHHSSGLVPRGSHMDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRD
Gene : PLA2G16
Gene ID : 11145
Uniprot ID : P53816
Source: E.coli.
MW :15.93kD.
Recombinant Human PLA2G16 is produced by our E.coli expression system and the target gene encoding Asp12-Asp132 is expressed with a 6His tag at the N-terminus. Group XVI Phospholipase A1/A2 (PLA2G16) belongs to the H-rev 107 family. PLA2G16 is expressed in a number of human tumors including ovarian carcinomas, lung carcinomas. PLA2G16 is involved in the regulation of differentiation and survival. PLA2G16 regulates adipocyte lipolysis and release of fatty acids through a G-protein coupled pathway involving prostaglandin and EP3. It has also been reported to play a crucial role in the development of obesity in mouse models.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Membrane, Cytoplasm, Cytoplasm, Peroxisome membrane
Tissue Specificity: Widely expressed. low expression, if any, in hematopoietic cells and thymus. In testis, confined to round spermatids. Expressed in normal ovarian epithelial cells. Down-regulated in some ovarian carcinomas and testicular germ cell tumors. Highly expressed in white adipose tissue (PubMed:19136964).
BioGrid: 116317. 6 interactions.
There are currently no product reviews