Recombinant Human GMP Reductase 1/GMPR (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris-HCl,40% glycerol,0.15M NaCl and 1mM DTT, pH8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAVPQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGVGPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGDVENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFSVDHHHHHH |
Source: Human Cells.
MW :38.5kD.
Recombinant Human GMP Reductase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser345 is expressed with a 6His tag at the C-terminus. GMP Reductase 1 (GMPR) is a member of the IMPDH/GMPR family. GMPR exists as a homotetramer and catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMP reductase gene expression may be regulated by MITF. At least two different alleles are known.
MW :38.5kD.
Recombinant Human GMP Reductase 1 is produced by our Mammalian expression system and the target gene encoding Met1-Ser345 is expressed with a 6His tag at the C-terminus. GMP Reductase 1 (GMPR) is a member of the IMPDH/GMPR family. GMPR exists as a homotetramer and catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and in maintaining the intracellular balance of A and G nucleotides. GMP reductase gene expression may be regulated by MITF. At least two different alleles are known.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 109028. 2 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
