Recombinant Human Galectin-Related Protein/LGALSL (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 100mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | AGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPESFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILCEHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGLEHHHHHH |
Source: E. coli.
MW :20kD.
Recombinant Human Galectin-Related Protein is produced by our E.coli expression system and the target gene encoding Ala2-Ser172 is expressed with a 6His tag at the C-terminus. Galectin-Related Protein (LGALSL) is a 172 amino acid protein that contains one Galectin domain. LGALSL does not appear to bind carbohydrates or lactose as the critical residues required for binding are not conserved. LGALSL may play a significant role in stimulating smooth muscle growth in developing alveolar wall vessels and the development of pulmonary capillaries.
MW :20kD.
Recombinant Human Galectin-Related Protein is produced by our E.coli expression system and the target gene encoding Ala2-Ser172 is expressed with a 6His tag at the C-terminus. Galectin-Related Protein (LGALSL) is a 172 amino acid protein that contains one Galectin domain. LGALSL does not appear to bind carbohydrates or lactose as the critical residues required for binding are not conserved. LGALSL may play a significant role in stimulating smooth muscle growth in developing alveolar wall vessels and the development of pulmonary capillaries.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 118863. 6 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
