Recombinant Human Galactokinase/GALK1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKDGLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLSSSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSLVPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARHVVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGGCTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCLLEHHHHHH |
Source: E.coli.
MW :43.3kD.
Recombinant Human Galactokinase is produced by our E.coli expression system and the target gene encoding Met1-Leu392 is expressed with a 6His tag at the C-terminus. Galactokinase belongs to the GHMP kinase family and GalK subfamily. Galactokinase is more important to the galactose metabolism pathway. It modifies galactose to create a similar molecule called Galactose-1-Phosphate.Thus, a series of additional steps converts Galactose-1-Phosphate to another simple sugar Glucose, which is the main energy source for most cells. Galactokinase deficiency results in Galactosemia II, an autosomal recessive deficiency characterized by congenital cataracts during infancy and presenile cataracts in the adult population. The cataracts are secondary to accumulation of Galactitol in the lenses.
MW :43.3kD.
Recombinant Human Galactokinase is produced by our E.coli expression system and the target gene encoding Met1-Leu392 is expressed with a 6His tag at the C-terminus. Galactokinase belongs to the GHMP kinase family and GalK subfamily. Galactokinase is more important to the galactose metabolism pathway. It modifies galactose to create a similar molecule called Galactose-1-Phosphate.Thus, a series of additional steps converts Galactose-1-Phosphate to another simple sugar Glucose, which is the main energy source for most cells. Galactokinase deficiency results in Galactosemia II, an autosomal recessive deficiency characterized by congenital cataracts during infancy and presenile cataracts in the adult population. The cataracts are secondary to accumulation of Galactitol in the lenses.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 108857. 17 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
