Recombinant Human GABA Receptor-Associated Protein-Like 1/GABARAPL1 (N-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK |
Source: E.coli.
MW :16.2kD.
Recombinant Human GABARAPL1 is produced by our E.coli expression system and the target gene encoding Met1-Lys117 is expressed with a 6His tag at the N-terminus. Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1 (GABARAPL1) is a cytoplasmic protein that belongs to the MAP1 LC3 family. GABARAPL1 is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle. It can interact with GABRG2, OPRK1 and beta-Tubulin. GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.
MW :16.2kD.
Recombinant Human GABARAPL1 is produced by our E.coli expression system and the target gene encoding Met1-Lys117 is expressed with a 6His tag at the N-terminus. Gamma-Aminobutyric Acid Receptor-Associated Protein-Like 1 (GABARAPL1) is a cytoplasmic protein that belongs to the MAP1 LC3 family. GABARAPL1 is expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta, and skeletal muscle. It can interact with GABRG2, OPRK1 and beta-Tubulin. GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Cytoplasmic vesicle membrane, Endoplasmic reticulum, Golgi apparatus, Cytoplasmic vesicle |
| Post transnational modification: | The Legionella effector RavZ is a deconjugating enzyme that produces an ATG8 product that would be resistant to reconjugation by the host machinery due to the cleavage of the reactive C-terminal glycine. |
| Tissue Specificity: | Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta. |
| BioGrid: | 117223. 78 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
