Recombinant Human Follitropin Subunit beta/FSHB (C-6His)(Discontinued)

Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKEVDHHHHHH |
Source: Human Cells.
MW :13.5kD.
Recombinant Human FSHB is produced by our Mammalian expression system and the target gene encoding Asn19-Glu129 is expressed with a 6His tag at the C-terminus. Follitropin Subunit beta (FSHB) is a secreted protein that belongs to the glycoprotein hormones subunit beta family. The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. FSHB exists in a heterodimer of a common a chain and an unique beta chain that confers biological specificity to thyrotropin, lutropin, follitropin, and gonadotropin. FSHB stimulates development of follicle and spermatogenesis in the reproductive organs. Defects in FSHB are a cause of isolated follicle-stimulating hormone deficiency (IFSHD).
MW :13.5kD.
Recombinant Human FSHB is produced by our Mammalian expression system and the target gene encoding Asn19-Glu129 is expressed with a 6His tag at the C-terminus. Follitropin Subunit beta (FSHB) is a secreted protein that belongs to the glycoprotein hormones subunit beta family. The pituitary glycoprotein hormone family includes follicle-stimulating hormone, luteinizing hormone, chorionic gonadotropin, and thyroid-stimulating hormone. FSHB exists in a heterodimer of a common a chain and an unique beta chain that confers biological specificity to thyrotropin, lutropin, follitropin, and gonadotropin. FSHB stimulates development of follicle and spermatogenesis in the reproductive organs. Defects in FSHB are a cause of isolated follicle-stimulating hormone deficiency (IFSHD).
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
BioGrid: | 108766. 1 interactions. |
There are currently no product reviews
|