Recombinant Human Fms-Related Tyrosine Kinase 3 Ligand/FLT3LG (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl,pH8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPVDHHHHHH |
Source: Human Cells.
MW :18.9kD.
Recombinant Human Fms-like Tyrosine Kinase 3 Ligand is produced by our Mammalian expression system and the target gene encoding Thr27-Pro184 is expressed with a 6His tag at the C-terminus. Fms-Related Tyrosine Kinase 3 Ligand (FLT3LG) is a hematopoietic four helical bundle cytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors by activiation of Flt 3 receptor.
MW :18.9kD.
Recombinant Human Fms-like Tyrosine Kinase 3 Ligand is produced by our Mammalian expression system and the target gene encoding Thr27-Pro184 is expressed with a 6His tag at the C-terminus. Fms-Related Tyrosine Kinase 3 Ligand (FLT3LG) is a hematopoietic four helical bundle cytokine. It is structurally homologous to stem cell factor (SCF) and colony stimulating facor 1 (CSF-1). In synergy with other growth factors, Flt3 ligand stimulates the proliferation and differentiation of various blood cell progenitors by activiation of Flt 3 receptor.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 108611. 2 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
