Recombinant Human Fibroblast Growth Factor 8/FGF-8F (N-6His)(Discontinued)

Product code: 32-8582

Shipping Info:

For estimated delivery dates, please contact us at [email protected]

Write a review for this product on BioCompare
Get $20 gift card from Amazon

Shipping Info:

For estimated delivery dates, please contact us at [email protected]


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT,pH 7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MGSSHHHHHHSSGLVPRGSHMQEGPGRGPALGRELASLFRAGREPQGVSQQVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
Gene : FGF8
Gene ID : 2253
Uniprot ID : P55075
Source: E.coli.
MW :27.7kD.
Recombinant Human Fibroblast growth factor 8f is produced by our E.coli expression system and the target gene encoding Gln23-Arg244 is expressed with a 6His tag at the N-terminus. Fibroblast growth factor 8 (FGF­8) is a member of the fibroblast growth factor family. It is discovered as a growth factor essential for the androgen-­dependent growth of mouse mammary carcinoma cells. Mouse FGF­8b shares 100% aa identity with human FGF­8b. FGF­8 is widely expressed during embryogenesis, and mediates epithelial­-mesenchymal transitions. It plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. It is required for normal brain, eye, ear, limb development during embryogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
BioGrid: 108544. 124 interactions.
There are currently no product reviews

Customers who purchased this product also purchased

Most viewed Products