-->

Recombinant Human Fibroblast Growth Factor 4/FGF-4

Product code: 32-8858

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com

Write a review for this product on BioCompare
Get $20 gift card from Amazon
Size
Price

Available Pack Size(s)

  •   10 µg

  •  50 µg

  • $371.00 

  • $565.00 

-->

Shipping Info:

For estimated delivery dates, please contact us at support@abeomics.com


Amount : 50 µg
Content : Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4.
Storage condition : Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
AA sequence : MSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Gene : FGF4
Gene ID : 2249
Uniprot ID : P08620
Source: E.coli.
MW :16.9kD.
Recombinant Human Fibroblast Growth Factor 4 is produced by our E.coli expression system and the target gene encoding Ser54-Leu206 is expressed. Fibroblast growth factor 4(FGF-4) is a heparin binding member of the FGF family. The human FGF4 cDNA encodes 206 amino acids (aa) with a 33 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C-terminus. Mature human FGF4 shares 91%, 82%, 94% and 91% aa identity with mouse, rat, canine and bovine FGF4, respectively. Human FGF-4 has been shown to exhibit cross species activity. Expression of FGF-4 and its receptors, FGF R1c, 2c, 3c and 4, is spatially and temporally regulated during embryonic development. FGF-4 is proposed to play a physiologically relevant role in human embryonic stem cell selfrenewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in vitro. FGF-4 is mitogenic for fibroblasts and endothelial cells in vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.

Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.

For Research Use Only. Not for use in diagnostic/therapeutics procedures.

Subcellular location: Secreted
There are currently no product reviews

Customers who purchased this product also purchased