Recombinant Human Fc Receptor-Like Protein 1/FCRL1/CD307a (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNVDHHHHHH |
Source: Human Cells.
MW :32.24kD.
Recombinant Human FcRL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asn303 is expressed with a 6His tag at the C-terminus. Fc Receptor-Like Protein 1 (FCRL1) is a single-pass type I membrane protein that may function as an activating coreceptor in B cells. FCRL1 is primarily expressed in secondary lymphoid tissues by mature subsets of B cells. It can be detected in the spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. It is specifically expressed by mature B lineage cells with higher expression at the protein level in naive B cells compared to memory B cells. FCRL1 contains three extracellular C2-like immunoglobulin domains, a transmembrane domain, and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs and may play a role in the regulation of cancer cell growth.
MW :32.24kD.
Recombinant Human FcRL1 is produced by our Mammalian expression system and the target gene encoding Ala17-Asn303 is expressed with a 6His tag at the C-terminus. Fc Receptor-Like Protein 1 (FCRL1) is a single-pass type I membrane protein that may function as an activating coreceptor in B cells. FCRL1 is primarily expressed in secondary lymphoid tissues by mature subsets of B cells. It can be detected in the spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. It is specifically expressed by mature B lineage cells with higher expression at the protein level in naive B cells compared to memory B cells. FCRL1 contains three extracellular C2-like immunoglobulin domains, a transmembrane domain, and a cytoplasmic domain with two immunoreceptor-tyrosine activation motifs and may play a role in the regulation of cancer cell growth.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated on tyrosines upon activation. |
| Tissue Specificity: | Primarily expressed in secondary lymphoid tissues by mature subsets of B-cells. Detected in spleen, lymph node, heart, skeletal muscle, kidney, liver and placenta. Specifically expressed by mature B lineage cells with higher expression in naive versus memory B-cells (at protein level). |
| BioGrid: | 125427. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
