Recombinant Human Fc gamma RIIIB/FCGR3B/CD16b (C-Fc-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | TEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFSPPGYQVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH |
Source: Human Cells.
MW :51.4kD.
Recombinant Human Fc gamma RIIIB is produced by our Mammalian expression system and the target gene encoding Thr20-Gln208 is expressed with a Fc, 6His tag at the C-terminus. Low affinity immunoglobulin gamma Fc region receptor III-B, also known as Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCG3, FCGR3, CD16b and FCGR3B. FCGR3B is a GPI-anchor membrane protein and contains two Ig-like C2 type domains. FCGR3B can be expressed in orphonuclear leukocytes and stimulated eosinophils. FCGR3B can interact with INPP5D/SHIP1. FCGR3B localizes in the FCGR gene cluster is a CN polymorphic gene involved in the recruitment of polymorphonuclear neutrophils to sites of inflammation and their activation. FCGR3B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
MW :51.4kD.
Recombinant Human Fc gamma RIIIB is produced by our Mammalian expression system and the target gene encoding Thr20-Gln208 is expressed with a Fc, 6His tag at the C-terminus. Low affinity immunoglobulin gamma Fc region receptor III-B, also known as Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCG3, FCGR3, CD16b and FCGR3B. FCGR3B is a GPI-anchor membrane protein and contains two Ig-like C2 type domains. FCGR3B can be expressed in orphonuclear leukocytes and stimulated eosinophils. FCGR3B can interact with INPP5D/SHIP1. FCGR3B localizes in the FCGR gene cluster is a CN polymorphic gene involved in the recruitment of polymorphonuclear neutrophils to sites of inflammation and their activation. FCGR3B may serve as a trap for immune complexes in the peripheral circulation which does not activate neutrophils.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane, Secreted |
| Post transnational modification: | The soluble form is produced by a proteolytic cleavage. |
| Tissue Specificity: | Expressed specifically by polymorphonuclear leukocytes (neutrophils). Also expressed by stimulated eosinophils. |
| BioGrid: | 108509. 22 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
