Recombinant Human Fc gamma RIIb/CD32b (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | TPAAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPVDHHHHHH |
Source: Human Cells.
MW :20.64kD.
Recombinant Human Fc-gamma RIIb is produced by our Mammalian expression system and the target gene encoding Thr43-Pro217 is expressed with a 6His tag at the C-terminus. Fc gamma RIIB is a low affinity receptor that recognizes the Fc portion of IgG. The human CD32 group consists of Fc gamma RIIA, Fc gamma RIIB, and Fc gamma RIIC proteins that share 94-99% sequence identity in their extracellular domains but differ substantially in their transmembrane and cytoplasmic domains. Fc gamma RII protein is expressed on cells of both myeloid and lymphoid lineages as well as on cells of non-hematopoietic origin. Fc gamma RIIB has an intrinsic cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM) and delivers an inhibitory signal upon ligand binding. Ligation of Fc gamma RIIB on B cells down-regulates antibody production and in some circumstances may promote apoptosis. Co-ligation of Fc gamma RIIB on dendritic cells inhibits maturation and blocks cell activation. Fc gamma RIIB may also be a target for monoclonal antibody therapy for malignancies. Fc gamma RIIB plays an important negative-regulating role through modulating the signals from activation receptors.
MW :20.64kD.
Recombinant Human Fc-gamma RIIb is produced by our Mammalian expression system and the target gene encoding Thr43-Pro217 is expressed with a 6His tag at the C-terminus. Fc gamma RIIB is a low affinity receptor that recognizes the Fc portion of IgG. The human CD32 group consists of Fc gamma RIIA, Fc gamma RIIB, and Fc gamma RIIC proteins that share 94-99% sequence identity in their extracellular domains but differ substantially in their transmembrane and cytoplasmic domains. Fc gamma RII protein is expressed on cells of both myeloid and lymphoid lineages as well as on cells of non-hematopoietic origin. Fc gamma RIIB has an intrinsic cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM) and delivers an inhibitory signal upon ligand binding. Ligation of Fc gamma RIIB on B cells down-regulates antibody production and in some circumstances may promote apoptosis. Co-ligation of Fc gamma RIIB on dendritic cells inhibits maturation and blocks cell activation. Fc gamma RIIB may also be a target for monoclonal antibody therapy for malignancies. Fc gamma RIIB plays an important negative-regulating role through modulating the signals from activation receptors.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated by the SRC-type Tyr-kinases LYN and BLK. |
| Tissue Specificity: | Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells. |
| BioGrid: | 108507. 5 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
