Recombinant Human Fatty Acid-Binding Protein 2/FABP2/I-FABP ((N, C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDLEHHHHHH |
Source: E.coli.
MW :18.44kD.
Recombinant Human FABP2 is produced by our E.coli expression system and the target gene encoding Met1-Asp132 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Fatty Acid-Binding Protein 2 (FABP2) is a cytoplasm protein that belongs to the Fatty-acid binding protein (FABP) family of calycin superfamily. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP2 is expressed in the small intestine and at much lower levels in the large intestine, the highest expression levels in the jejunum. FABP2 binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis and may also help maintain energy homeostasis by functioning as a lipid sensor.
MW :18.44kD.
Recombinant Human FABP2 is produced by our E.coli expression system and the target gene encoding Met1-Asp132 is expressed with a 6His tag at the N-terminus, 6His tag at the C-terminus. Fatty Acid-Binding Protein 2 (FABP2) is a cytoplasm protein that belongs to the Fatty-acid binding protein (FABP) family of calycin superfamily. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids. FABP2 is expressed in the small intestine and at much lower levels in the large intestine, the highest expression levels in the jejunum. FABP2 binds saturated long-chain fatty acids with a high affinity, but binds with a lower affinity to unsaturated long-chain fatty acids. FABP2 is probably involved in triglyceride-rich lipoprotein synthesis and may also help maintain energy homeostasis by functioning as a lipid sensor.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Expressed in the small intestine and at much lower levels in the large intestine. Highest expression levels in the jejunum. |
| BioGrid: | 108467. 3 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
