Recombinant Human Eukaryotic Translation Initiation Factor 5A-2/EIF5A2 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl, pH 8.0. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MGSSHHHHHHSSGLVPRGSHMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK |
Source: E. coli.
MW :18.9kD.
Recombinant Human EIF5A2 is produced by our E.coli expression system and the target gene encoding Met1-Lys153 is expressed with a 6His tag at the N-terminus. EIF5A2 is a member of the eIF-5A family. It is a 153 amino acids protein that in humans is encoded by the EIF5A2 gene. EIF5A2 is expressed in ovarian and colorectal cancer cell lines and highly expressed in testis.It has an important function at the level of mRNA turnover and mediates effects of polyamines on neuronal process extension and survival. It plays an important role in brain development and function, and in skeletal muscle stem cell differentiation.
MW :18.9kD.
Recombinant Human EIF5A2 is produced by our E.coli expression system and the target gene encoding Met1-Lys153 is expressed with a 6His tag at the N-terminus. EIF5A2 is a member of the eIF-5A family. It is a 153 amino acids protein that in humans is encoded by the EIF5A2 gene. EIF5A2 is expressed in ovarian and colorectal cancer cell lines and highly expressed in testis.It has an important function at the level of mRNA turnover and mediates effects of polyamines on neuronal process extension and survival. It plays an important role in brain development and function, and in skeletal muscle stem cell differentiation.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cytoplasm, Nucleus, Endoplasmic reticulum membrane, Nucleus |
Post transnational modification: | eIF-5A seems to be the only eukaryotic protein to have a hypusine residue which is a post-translational modification of a lysine by the addition of a butylamino group (from spermidine). |
Tissue Specificity: | Expressed in ovarian and colorectal cancer cell lines (at protein level). Highly expressed in testis. Overexpressed in some cancer cells. |
BioGrid: | 121162. 29 interactions. |
There are currently no product reviews
|