Recombinant Human ETS1/EWSR2/P54 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl,1mM EDTA,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT |
Source: E. coli.
MW :33kD.
Recombinant Human ETS1 is produced by our E.coli expression system and the target gene encoding Met1-Thr272 is expressed with a 6His tag at the N-terminus. ETS1 Protein (ETS1) is a nuclear protein that belongs to the ETS family. Members of this family recognize the core consensus DNA sequence GGAA/T in target genes. Proteins function either as transcriptional activators or repressors of numerous genes. They are involved in stem cell development, cell senescence and death, and tumorigenesis. ETS1 is a transcription factor, containing one ETS DNA-binding domain and one PNT (pointed) domain. it has been shown to interact with TTRAP, UBE2I and Death Associated Protein 6.
MW :33kD.
Recombinant Human ETS1 is produced by our E.coli expression system and the target gene encoding Met1-Thr272 is expressed with a 6His tag at the N-terminus. ETS1 Protein (ETS1) is a nuclear protein that belongs to the ETS family. Members of this family recognize the core consensus DNA sequence GGAA/T in target genes. Proteins function either as transcriptional activators or repressors of numerous genes. They are involved in stem cell development, cell senescence and death, and tumorigenesis. ETS1 is a transcription factor, containing one ETS DNA-binding domain and one PNT (pointed) domain. it has been shown to interact with TTRAP, UBE2I and Death Associated Protein 6.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Nucleus |
| Post transnational modification: | Ubiquitinated; which induces proteasomal degradation. |
| Tissue Specificity: | Highly expressed within lymphoid cells. Isoforms c-ETS-1A and Ets-1 p27 are both detected in all fetal tissues tested, but vary with tissue type in adult tissues. None is detected in brain or kidney. |
| BioGrid: | 108414. 53 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
