Recombinant Human Estrogen Receptor beta/ER beta/NR3A2 (N-6His)(Discontinued)

Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 50mM TrisHCl,pH8.0. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MGSSHHHHHHSSGLVPRGSHMDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA |
Source: E.coli.
MW :38.1kD.
Recombinant Human Estrogen Receptor Beta is produced by our E.coli expression system and the target gene encoding Met1-Ala323 is expressed with a 6His tag at the N-terminus. Estrogen Receptor Beta (ESR2) is a nuclear protein that belongs to the nuclear hormone receptor family of NR3 subfamily. It contains one nuclear receptor DNA-binding domain and is expressed in many tissues at a lower level. ESR2 is a nuclear hormone receptor. It binds estrogens with an affinity similar to that of ESR1 and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.
MW :38.1kD.
Recombinant Human Estrogen Receptor Beta is produced by our E.coli expression system and the target gene encoding Met1-Ala323 is expressed with a 6His tag at the N-terminus. Estrogen Receptor Beta (ESR2) is a nuclear protein that belongs to the nuclear hormone receptor family of NR3 subfamily. It contains one nuclear receptor DNA-binding domain and is expressed in many tissues at a lower level. ESR2 is a nuclear hormone receptor. It binds estrogens with an affinity similar to that of ESR1 and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Nucleus |
Post transnational modification: | Phosphorylation at Ser-87 and Ser-105 recruits NCOA1. |
Tissue Specificity: | Isoform 1 is expressed in testis and ovary, and at a lower level in heart, brain, placenta, liver, skeletal muscle, spleen, thymus, prostate, colon, bone marrow, mammary gland and uterus. Also found in uterine bone, breast, and ovarian tumor cell lines, but not in colon and liver tumors. Isoform 2 is expressed in spleen, thymus, testis and ovary and at a lower level in skeletal muscle, prostate, colon, small intestine, leukocytes, bone marrow, mammary gland and uterus. Isoform 4 is found in testis. Isoform 5 is expressed in testis, and at a lower level in spleen, thymus, ovary, mammary gland and uterus. Isoform 6 is expressed in testis, placenta, skeletal muscle, spleen and leukocytes, and at a lower level in heart, lung, liver, kidney, pancreas, thymus, prostate, colon, small intestine, bone marrow, mammary gland and uterus. Not expressed in brain. |
BioGrid: | 108404. 100 interactions. |
There are currently no product reviews
|