Recombinant Human Ephrin A Receptor 7/EphA7 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QAAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHSFSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGRNDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNGVSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKYYEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATGKMFEATAVSSEQNPVIVDHHHHHH |
Source: Human Cells.
MW :60.19kD.
Recombinant Human Ephrin A Receptor 7 is produced by our Mammalian expression system and the target gene encoding Gln28-Ile556 is expressed with a 6His tag at the C-terminus. Ephrin Type-A Receptor 7 (EPHA7) is a single-pass type I membrane protein which belongs to the Eph family of transmembrane receptor tyrosine kinases. It contains two fibronectin type-III domains, one protein kinase domain and one SAM (sterile alpha motif) domain. EPHA7 is a receptor for members of the ephrin-A family. Eph receptors are largely expressed throughout the ectoderm, mesoderm, and endoderm of vertebrate embryos. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. EPHA7 is expressed at a substantial level in most human lung cancers. The high expression of EPHA7 protein may participate in the malignancy transformation, invasion progression and metastasis of primary hepatocellular carcinoma. EPHA7 may involve in smoking related lung carcinogenesis.
MW :60.19kD.
Recombinant Human Ephrin A Receptor 7 is produced by our Mammalian expression system and the target gene encoding Gln28-Ile556 is expressed with a 6His tag at the C-terminus. Ephrin Type-A Receptor 7 (EPHA7) is a single-pass type I membrane protein which belongs to the Eph family of transmembrane receptor tyrosine kinases. It contains two fibronectin type-III domains, one protein kinase domain and one SAM (sterile alpha motif) domain. EPHA7 is a receptor for members of the ephrin-A family. Eph receptors are largely expressed throughout the ectoderm, mesoderm, and endoderm of vertebrate embryos. EPHA7 functions as a repulsive guidance molecule during the targeting of retinal axons to the superior colliculus and of neocortical axons to the thalamus. EPHA7 is expressed at a substantial level in most human lung cancers. The high expression of EPHA7 protein may participate in the malignancy transformation, invasion progression and metastasis of primary hepatocellular carcinoma. EPHA7 may involve in smoking related lung carcinogenesis.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated. |
| Tissue Specificity: | Widely expressed. |
| BioGrid: | 108359. 54 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
