Recombinant Human Endocan/ESM-1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | WSNNYAVDCPQHCDSSECKSSPRCERTVLDDCGCCRVCAAGRGETCYRTVSGMDGMKCGPGLRCQPSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQSGICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDMASGDGNIVREEVVKENAAGSPVMRKWLNPRVDHHHHHH |
Source: Human Cells.
MW :19.16kD.
Recombinant Human ESM-1 is produced by our Mammalian expression system and the target gene encoding Trp20-Arg184 is expressed with a 6His tag at the C-terminus. ESM-1, short from Endothelial cell-specific molecule 1, is expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney. It is a secretory protein, and can be inducted by TNF and IL1B/interleukin-1beta, but not IL4/interleukin-4. This protein plays great roles in angiogenesis, sprouting, and may have potent implications in lung endothelial cell-leukocyte interactions.
MW :19.16kD.
Recombinant Human ESM-1 is produced by our Mammalian expression system and the target gene encoding Trp20-Arg184 is expressed with a 6His tag at the C-terminus. ESM-1, short from Endothelial cell-specific molecule 1, is expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney. It is a secretory protein, and can be inducted by TNF and IL1B/interleukin-1beta, but not IL4/interleukin-4. This protein plays great roles in angiogenesis, sprouting, and may have potent implications in lung endothelial cell-leukocyte interactions.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | O-glycosylated; contains chondroitin sulfate and dermatan sulfate. |
| Tissue Specificity: | Expressed in lung, on the vascular capillary network within alveolar walls, and also at lower level in kidney. |
| BioGrid: | 116265. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
