Recombinant Human EIF4E-Binding Protein 1/EIF4EBP1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMSGGSSCSQTPSRAIPATRRVVLGDGVQLPPGDYSTTPGGTLFSTTPGGTRIIYDRKFLMECRNSPVTKTPPRDLPTIPGVTSPSSDEPPMEASQSHLRNSPEDKRAGGEESQFEMDI |
Source: E.coli.
MW :14.74kD.
Recombinant Human EIF4E-Binding Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Ile118 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 1 (4EBP1) is a number of the eIF4E-binding protein family. 4EBP1 regulates eIF4E activity by preventing its assembly into the eIF4F complex. 4EBP1 mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. Non-phosphorylated 4EBP1 competes with EIF4G1/EIF4G3 to interact with EIF4E. 4EBP1 is phosphorylated in response to various signals including insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. 4EBP1 has a role in progression of breast neoplasms through cell signaling.
MW :14.74kD.
Recombinant Human EIF4E-Binding Protein 1 is produced by our E.coli expression system and the target gene encoding Met1-Ile118 is expressed with a 6His tag at the N-terminus. Eukaryotic Translation Initiation Factor 4E-Binding Protein 1 (4EBP1) is a number of the eIF4E-binding protein family. 4EBP1 regulates eIF4E activity by preventing its assembly into the eIF4F complex. 4EBP1 mediates the regulation of protein translation by hormones, growth factors and other stimuli that signal through the MAP kinase and mTORC1 pathways. Non-phosphorylated 4EBP1 competes with EIF4G1/EIF4G3 to interact with EIF4E. 4EBP1 is phosphorylated in response to various signals including insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation. 4EBP1 has a role in progression of breast neoplasms through cell signaling.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Post transnational modification: | Ubiquitinated: when eIF4E levels are low, hypophosphorylated form is ubiquitinated by the BCR(KLHL25) complex, leading to its degradation and serving as a homeostatic mechanism to maintain translation and prevent eIF4E inhibition when eIF4E levels are low. Not ubiquitinated when hyperphosphorylated (at Thr-37, Thr-46, Ser-65 and Thr-70) or associated with eIF4E. |
| BioGrid: | 108293. 45 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
