Recombinant Human d(3,5)-d(2,4)-Dienoyl-CoA Isomerase, Mitochondrial/ECH1
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris,100mM NaCl,10% Glycerol,pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMTGSSAQEEASGVALGEAPDHSYESLRVTSAQKHVLHVQLNRPNKRNAMNKVFWREMVECFNKISRDADCRAVVISGAGKMFTAGIDLMDMASDILQPKGDDVARISWYLRDIITRYQETFNVIERCPKPVIAAVHGGCIGGGVDLVTACDIRYCAQDAFFQVKEVDVGLAADVGTLQRLPKVIGNQSLVNELAFTARKMMADEALGSGLVSRVFPDKEVMLDAALALAAEISSKSPVAVQSTKVNLLYSRDHSVAESLNYVASWNMSMLQTQDLVKSVQATTENKELKTVTFSKL |
Source: E.coli.
MW :34.45kD.
Recombinant Human ECH1 is produced by our E.coli expression system and the target gene encoding Thr34-Leu328 is expressed with a 6His tag at the N-terminus. Human delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase(ECH1) is a member of the hydratase/isomerase superfamily and contains a C-terminal peroxisomal targeting sequence and localizes to peroxisomes. ECH1 shows high sequence similarity to enoyl-CoA hydratases of several species, particularly within a conserved domain characteristic of these proteins. The rat orthologlocalizes to the matrix of both the peroxisome and mitochondria.It can isomerize 3-trans, 5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. ECH1 plays an important role in the auxiliary step of the fatty acid beta-oxidation pathway.
MW :34.45kD.
Recombinant Human ECH1 is produced by our E.coli expression system and the target gene encoding Thr34-Leu328 is expressed with a 6His tag at the N-terminus. Human delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase(ECH1) is a member of the hydratase/isomerase superfamily and contains a C-terminal peroxisomal targeting sequence and localizes to peroxisomes. ECH1 shows high sequence similarity to enoyl-CoA hydratases of several species, particularly within a conserved domain characteristic of these proteins. The rat orthologlocalizes to the matrix of both the peroxisome and mitochondria.It can isomerize 3-trans, 5-cis-dienoyl-CoA to 2-trans,4-trans-dienoyl-CoA, indicating that it is a delta3,5-delta2,4-dienoyl-CoA isomerase. ECH1 plays an important role in the auxiliary step of the fatty acid beta-oxidation pathway.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Mitochondrion, Peroxisome |
| BioGrid: | 108220. 109 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
