Recombinant Human Cysteine-Rich Secretory Protein 3/CRISP-3/SGP28 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | NEDKDPAFTALLTTQTQVQREIVNKHNELRRAVSPPARNMLKMEWNKEAAANAQKWANQCNYRHSNPKDRMTSLKCGENLYMSSASSSWSQAIQSWFDEYNDFDFGVGPKTPNAVVGHYTQVVWYSSYLVGCGNAYCPNQKVLKYYYVCQYCPAGNWANRLYVPYEQGAPCASCPDNCDDGLCTNGCKYEDLYSNCKSLKLTLTCKHQLVRDSCKASCNCSNSIYVDHHHHHH |
Source: Human Cells.
MW :26.54kD.
Recombinant Human CRISP-3 is produced by our Mammalian expression system and the target gene encoding Asn21-Tyr245 is expressed with a 6His tag at the C-terminus. Cysteine-rich secretory protein 3 (CRISP-3) is a secreted protein,containing 1 SCP domain and 1 ShKT domain.It is belongs to the CRISP family. CRISP-3 is a glycoprotein that belongs to the family of cysteine-rich secretory proteins (CRISPs) which was originally discovered in human neutrophilic granulocytes. CRISP-3 is also widely distibuted in exocrine glands (salivary glands, pancreas and prostate), eosinophilic granulocytes and to a lower level in epididymis, ovary, thymus and colon. The presence of CRISP-3 in neutrophils, eosinophils and in exocrine secretions indicates a role in innate host defense. The antibody has been raised against recombinant C-terminally truncated form of CRISP-3 and recognizes both the N-glycosylated and non-glycosylated form of the mature protein.
MW :26.54kD.
Recombinant Human CRISP-3 is produced by our Mammalian expression system and the target gene encoding Asn21-Tyr245 is expressed with a 6His tag at the C-terminus. Cysteine-rich secretory protein 3 (CRISP-3) is a secreted protein,containing 1 SCP domain and 1 ShKT domain.It is belongs to the CRISP family. CRISP-3 is a glycoprotein that belongs to the family of cysteine-rich secretory proteins (CRISPs) which was originally discovered in human neutrophilic granulocytes. CRISP-3 is also widely distibuted in exocrine glands (salivary glands, pancreas and prostate), eosinophilic granulocytes and to a lower level in epididymis, ovary, thymus and colon. The presence of CRISP-3 in neutrophils, eosinophils and in exocrine secretions indicates a role in innate host defense. The antibody has been raised against recombinant C-terminally truncated form of CRISP-3 and recognizes both the N-glycosylated and non-glycosylated form of the mature protein.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Tissue Specificity: | Salivary gland, pancreas and prostate > epididymis, ovary, thymus and colon. |
| BioGrid: | 115605. 1 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
