Recombinant Human Connective Tissue Growth Factor/CTGF/CCN2
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA |
Source: Human Cells.
MW :16.3kD.
Recombinant Human CTGF is produced by our Mammalian expression system and the target gene encoding Glu27-Ala180 is expressed. CTGF belongs to the CCN (CTGF/Cyr61/Cef10/NOVH) protein family, which is comprised of six secreted proteins that reside in the extracellular matrix (ECM). CTGF causes a variety of cellular responses including reduced cell adhesion and enhanced cell migration and proliferation. CTGF has also been shown to be essential for epithelial to mesenchymal transition (EMT), a process whereby normal functioning cells morph into ones that produce mainly scar tissue (of which collagen in the major protein component).
MW :16.3kD.
Recombinant Human CTGF is produced by our Mammalian expression system and the target gene encoding Glu27-Ala180 is expressed. CTGF belongs to the CCN (CTGF/Cyr61/Cef10/NOVH) protein family, which is comprised of six secreted proteins that reside in the extracellular matrix (ECM). CTGF causes a variety of cellular responses including reduced cell adhesion and enhanced cell migration and proliferation. CTGF has also been shown to be essential for epithelial to mesenchymal transition (EMT), a process whereby normal functioning cells morph into ones that produce mainly scar tissue (of which collagen in the major protein component).
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted, Secreted |
| Tissue Specificity: | Expressed in bone marrow and thymic cells. Also expressed one of two Wilms tumors tested. |
| BioGrid: | 107872. 14 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
