Recombinant Human Complement Component C8 gamma Chain/C8G (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVNVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR |
Source: E. coli.
MW :22.6kD.
Recombinant Human Complement component C8 gamma is produced by our E.coli expression system and the target gene encoding Gln21-Arg202 is expressed with a 6His tag at the N-terminus. Complement component C8 is a constituent of the membrane attack complex, C8 alpha, C8 beta and C8G. C8G is a secreted protein and comsists a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 alpha and C8 beta play an important role in complement-mediated bacterial killing together.C8 is involved in the formation of Membrane Attack Complex on bacterial cell membranes. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol. Patients lacking C8 are susceptible to certain bacterial infections.
MW :22.6kD.
Recombinant Human Complement component C8 gamma is produced by our E.coli expression system and the target gene encoding Gln21-Arg202 is expressed with a 6His tag at the N-terminus. Complement component C8 is a constituent of the membrane attack complex, C8 alpha, C8 beta and C8G. C8G is a secreted protein and comsists a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 alpha and C8 beta play an important role in complement-mediated bacterial killing together.C8 is involved in the formation of Membrane Attack Complex on bacterial cell membranes. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol. Patients lacking C8 are susceptible to certain bacterial infections.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| BioGrid: | 107194. 6 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
