Recombinant Human Coiled-Coil Domain-Containing Protein 134/CCDC134 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | TLRTSLDPSLEIYKKMFEVKRREQLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLTAADVLPDGPFPQDEKLKDAFSHVVENTAFFGDVVLRFPRIVHYYFDHNSNWNLLIRWGISFCNQTGVFNQGPHSPILSLMAQELGISEKDSNFQNPFKIDRTEFIPSTDPFQKALREEEKRRKKEEKRKEIRKGPRISRSQSELVDHHHHHH |
Source: Human Cells.
MW :25.3kD.
Recombinant Human CCDC134 is produced by our Mammalian expression system and the target gene encoding Thr23-Leu229 is expressed with a 6His tag at the C-terminus. CCDC134, which is short for Coiled-coil domain-containing protein 134, belongs to the UPF0388 family. It is a 229 aa. protein with a 22 aa. signal peptide, and the last 207 aa. is Coiled-coil domain. This protein is usually expressed in extracellular region.
MW :25.3kD.
Recombinant Human CCDC134 is produced by our Mammalian expression system and the target gene encoding Thr23-Leu229 is expressed with a 6His tag at the C-terminus. CCDC134, which is short for Coiled-coil domain-containing protein 134, belongs to the UPF0388 family. It is a 229 aa. protein with a 22 aa. signal peptide, and the last 207 aa. is Coiled-coil domain. This protein is usually expressed in extracellular region.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Nucleus, Cytoplasm, Secreted, Endoplasmic reticulum |
| Post transnational modification: | O-glycosylated, with additional sialic acid modifications. |
| Tissue Specificity: | Expressed in cervical gland, cervical squamous epithelium, endometrium, stomach, kidney distal convoluted tubule, spermatogenic cells in testis, mammary gland, liver and striated muscle (at protein level) (PubMed:18087676, PubMed:23070808). Also detected in placenta (PubMed:18087676). Highest expression in testis relative to other tissues (PubMed:18087676). Detected in T cells and dendritic cells; highly expressed in activated CD8(+) T cells, and also expressed at lower levels in CD4(+) T cells (PubMed:25125657). |
| BioGrid: | 122966. 5 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
