Recombinant Human Choriogonadotropin Subunit beta/CGB5 (C-6His)(Discontinued)
![](images/categories/discont_prod_icon.jpg)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl, pH 7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQVDHHHHHH |
Source: Human Cells.
MW :16.5kD.
Recombinant Human Choriogonadotropin subunit beta is produced by our Mammalian expression system and the target gene encoding Ser21-Gln165 is expressed with a 6His tag at the C-terminus. Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
MW :16.5kD.
Recombinant Human Choriogonadotropin subunit beta is produced by our Mammalian expression system and the target gene encoding Ser21-Gln165 is expressed with a 6His tag at the C-terminus. Choriogonadotropin subunit beta is also known as CG-beta, Chorionic gonadotrophin chain beta. It is a protein that in humans is encoded by the CGB gene. It belongs to the glycoprotein hormones subunit beta family. Choriogonadotropin subunit beta can stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Tissue Specificity: | High expression in the placenta throughout pregnancy. |
There are currently no product reviews
|