Recombinant Human cGMP-Dependent Protein Kinase 1/PRKG1 (C-6His)(Discontinued)
![](images/categories/discont_prod_icon.jpg)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM Tris,150mM NaCl,pH8.0. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDFVDHHHHHH |
Source: Human Cells.
MW :78.8kD.
Recombinant Human cGMP-Dependent Protein Kinase 1 is produced by our Mammalian expression system and the target gene encoding Gly2-Pro686 is expressed with a 6His tag at the C-terminus. cGMP-Dependent Protein Kinase 1 (PRKG1) belongs to the protein kinase superfamily and AGC Ser/Thr protein kinase family. PRKG1 contains one AGC-kinase C-terminal domain, two cyclic nucleotide-binding domains, and one protein kinase domain. PRKG1 is mainly expressed in the lung and placenta. PRKG1 acts as a key mediator of the nitric oxide (NO)/cGMP signaling pathway. PRKG1 can phosphorylate many proteins that regulate platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, feedback of the NO-signaling pathway, and other processes involved in several aspects of the CNS like axon guidance, hippocampal and cerebellar learning, circadian rhythm, and nociception.
MW :78.8kD.
Recombinant Human cGMP-Dependent Protein Kinase 1 is produced by our Mammalian expression system and the target gene encoding Gly2-Pro686 is expressed with a 6His tag at the C-terminus. cGMP-Dependent Protein Kinase 1 (PRKG1) belongs to the protein kinase superfamily and AGC Ser/Thr protein kinase family. PRKG1 contains one AGC-kinase C-terminal domain, two cyclic nucleotide-binding domains, and one protein kinase domain. PRKG1 is mainly expressed in the lung and placenta. PRKG1 acts as a key mediator of the nitric oxide (NO)/cGMP signaling pathway. PRKG1 can phosphorylate many proteins that regulate platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, feedback of the NO-signaling pathway, and other processes involved in several aspects of the CNS like axon guidance, hippocampal and cerebellar learning, circadian rhythm, and nociception.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cytoplasm |
Post transnational modification: | 65 kDa monomer is produced by proteolytic cleavage. |
Tissue Specificity: | Primarily expressed in lung and placenta. |
BioGrid: | 111578. 26 interactions. |
There are currently no product reviews
|