Recombinant Human CD79B/B29 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDVDHHHHHH |
Source: Human Cells.
MW :16.25kD.
Recombinant Human CD79B is produced by our Mammalian expression system and the target gene encoding Ala29-Asp159 is expressed with a 6His tag at the C-terminus. CD79B is a single-pass type I membrane protein. CD79B contains one Ig-like V-type domain and one ITAM domain. CD79B is required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR), which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79B enhances phosphorylation of CD79A, possibly by recruiting kinases that phosphorylate CD79A or by recruiting proteins that bind to CD79A and protect it from dephosphorylation.
MW :16.25kD.
Recombinant Human CD79B is produced by our Mammalian expression system and the target gene encoding Ala29-Asp159 is expressed with a 6His tag at the C-terminus. CD79B is a single-pass type I membrane protein. CD79B contains one Ig-like V-type domain and one ITAM domain. CD79B is required in cooperation with CD79A for initiation of the signal transduction cascade activated by the B-cell antigen receptor complex (BCR), which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. CD79B enhances phosphorylation of CD79A, possibly by recruiting kinases that phosphorylate CD79A or by recruiting proteins that bind to CD79A and protect it from dephosphorylation.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | Phosphorylated on tyrosine upon B-cell activation by SRC-type Tyr-kinases such as BLK, LYN and SYK. |
| Tissue Specificity: | B-cells. |
| BioGrid: | 107412. 110 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
