Recombinant Human CD47/IAP/OA3 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDHHHHHH |
Source: Human Cells.
MW :14.76kD.
Recombinant Human CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a 6His tag at the C-terminus. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
MW :14.76kD.
Recombinant Human CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a 6His tag at the C-terminus. CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. |
| BioGrid: | 107399. 26 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
