Recombinant Human Cathepsin L2/CTSL2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM MES, 150mM NaCl, pH 5.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | VPKFDQNLDTKWYQWKATHRRLYGANEEGWRRAVWEKNMKMIELHNGEYSQGKHGFTMAMNAFGDMTNEEFRQMMGCFRNQKFRKGKVFREPLFLDLPKSVDWRKKGYVTPVKNQKQCGSCWAFSATGALEGQMFRKTGKLVSLSEQNLVDCSRPQGNQGCNGGFMARAFQYVKENGGLDSEESYPYVAVDEICKYRPENSVANDTGFTVVAPGKEKALMKAVATVGPISVAMDAGHSSFQFYKSGIYFEPDCSSKNLDHGVLVVGYGFEGANSNNSKYWLVKNSWGPEWGSNGYVKIAKDKNNHCGIATAASYPNVVDHHHHHH |
Source: Human Cells.
MW :36.69kD.
Recombinant Human Cathepsin L2 is produced by our Mammalian expression system and the target gene encoding Val18-Val334 is expressed with a 6His tag at the C-terminus. Cathepsin L2 belongs to the Peptidase C1 family. Cathepsin L2 can be autocatalytically convertedto the mature form as a proenzyme in lysosomes at pH=7.0. Cathepsin L2 cannot be expressed in normal mammary gland, colon and peritumoral tissue, but it can be expressed in breast carcinomas and colorectal tissues. These suggeats Cathepsin L2 may play a role in tumor processes. Cathepsin L2 is specifically expressed in the testis, thymus, and corneal epithelium.
MW :36.69kD.
Recombinant Human Cathepsin L2 is produced by our Mammalian expression system and the target gene encoding Val18-Val334 is expressed with a 6His tag at the C-terminus. Cathepsin L2 belongs to the Peptidase C1 family. Cathepsin L2 can be autocatalytically convertedto the mature form as a proenzyme in lysosomes at pH=7.0. Cathepsin L2 cannot be expressed in normal mammary gland, colon and peritumoral tissue, but it can be expressed in breast carcinomas and colorectal tissues. These suggeats Cathepsin L2 may play a role in tumor processes. Cathepsin L2 is specifically expressed in the testis, thymus, and corneal epithelium.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Lysosome |
| Tissue Specificity: | Predominantly expressed in the thymus and testis. Also expressed in corneal epithelium, and to a lesser extent in conjunctival epithelium and skin. |
| BioGrid: | 107895. 31 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
