Recombinant Human Cathepsin D/CTSD (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM MES, 150mM NaCl, pH 5.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | LVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARLHHHHHH |
Source: Human Cells.
MW :43.8kD.
Recombinant Human Cathepsin D is produced by our Mammalian expression system and the target gene encoding Leu21-Leu412 is expressed with a 6His tag at the C-terminus. The protein acid protease active in intracellular protein breakdown and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. It is specificity similar to, but narrower than, that of pepsin A and it does not cleave the 4-Gln-|-His-5 bond in B chain of insulin. It consists of a light chain and a heavy chain and expressed in the aorta extrcellular space. The Val-58 allele is significantly overrepresented in demented patients (11.8%) compared with non-demented controls (4.9%). Carriers of the Val-58 allele have a 3.1-fold increased risk for developing AD than non-carriers.It belongs to the peptidase A1 family
MW :43.8kD.
Recombinant Human Cathepsin D is produced by our Mammalian expression system and the target gene encoding Leu21-Leu412 is expressed with a 6His tag at the C-terminus. The protein acid protease active in intracellular protein breakdown and involved in the pathogenesis of several diseases such as breast cancer and possibly Alzheimer disease. It is specificity similar to, but narrower than, that of pepsin A and it does not cleave the 4-Gln-|-His-5 bond in B chain of insulin. It consists of a light chain and a heavy chain and expressed in the aorta extrcellular space. The Val-58 allele is significantly overrepresented in demented patients (11.8%) compared with non-demented controls (4.9%). Carriers of the Val-58 allele have a 3.1-fold increased risk for developing AD than non-carriers.It belongs to the peptidase A1 family
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Lysosome, Melanosome, Secreted |
| Post transnational modification: | As well as the major heavy chain which starts at Leu-169, 2 minor forms starting at Gly-170 and Gly-171 have been identified (PubMed:1426530). An additional form starting at Ala-168 has also been identified (PubMed:27333034). |
| Tissue Specificity: | Expressed in the aorta extrcellular space (at protein level) (PubMed:20551380). Expressed in liver (at protein level) (PubMed:1426530). |
| BioGrid: | 107889. 46 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
