Recombinant Human cAMP-dependent Protein Kinase Inhibitor beta/PKI- beta (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, 20% Glycerol, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMRTDSSKMTDVESGVANFASSARAGRRNALPDIQSSAATDGTSDLPLKLEALSVKEDAKEKDEKTTQDQLEKPQNEEK |
Source: E.coli.
MW :10.6kD.
Recombinant Human PKI-beta is produced by our E.coli expression system and the target gene encoding Met1-Lys78 is expressed with a 6His tag at the N-terminus. cAMP-Dependent Protein Kinase Inhibitor beta (PKI- beta) is a member of the PKI family. It has been shown that PKI- beta is an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity; this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
MW :10.6kD.
Recombinant Human PKI-beta is produced by our E.coli expression system and the target gene encoding Met1-Lys78 is expressed with a 6His tag at the N-terminus. cAMP-Dependent Protein Kinase Inhibitor beta (PKI- beta) is a member of the PKI family. It has been shown that PKI- beta is an extremely potent competitive inhibitor of cAMP-dependent protein kinase activity; this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| BioGrid: | 111557. 5 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
![PE-Cy7 Conjugated Anti-CD34 / Mucosialin Monoclonal Antibody (Clone:4H11[APG])](https://d21vkl1rk084ej.cloudfront.net/images/30-1185PE-Cy7/1.jpg "PE-Cy7 Conjugated Anti-CD34 / Mucosialin Monoclonal Antibody (Clone:4H11[APG])")
