Recombinant Human Calmegin/CLGN (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | EFMDDDVETEDFEENSEEIDVNESELSSEIKYKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEELKENQVPGDRGLVLKSRAKHHAISAVLAKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTDDLILENFYDKTSYIIMFGPDKCGEDYKLHFIFRHKHPKTGVFEEKHAKPPDVDLKKFFTDRKTHLYTLVMNPDDTFEVLVDQTVVNKGSLLEDVVPPIKPPKEIEDPNDKKPEEWDERAKIPDPSAVKPEDWDESEPAQIEDSSVVKPAGWLDDEPKFIPDPNAEKPDDWNEDTDGEWEAPQILNPACRIGCGEWKPPMIDNPKYKGVWRPPLVDNPNYQGIWSPRKIPNPDYFEDDHPFLLTSFSALGLELWSMTSDIYFDNFIICSEKEVADHWAADGWRWKIMIANANKPGVLKQLMAAAEGHPWVDHHHHHH |
Source: Human Cells.
MW :52.9kD.
Recombinant Human Calmegin is produced by our Mammalian expression system and the target gene encoding Glu20-Trp471 is expressed with a 6His tag at the C-terminus. Calmegin (CLGN) is a member of the calreticulin family. Calmegin is a testis-specific endoplasmic reticulum chaperone protein. Calmegin binds calcium ions and interacts with PDILT. Calmegin may play a role in spermatogeneisis and infertility.
MW :52.9kD.
Recombinant Human Calmegin is produced by our Mammalian expression system and the target gene encoding Glu20-Trp471 is expressed with a 6His tag at the C-terminus. Calmegin (CLGN) is a member of the calreticulin family. Calmegin is a testis-specific endoplasmic reticulum chaperone protein. Calmegin binds calcium ions and interacts with PDILT. Calmegin may play a role in spermatogeneisis and infertility.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Endoplasmic reticulum membrane |
| Tissue Specificity: | Detected in testis (at protein level). Detected in testis. |
| BioGrid: | 107477. 38 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
