Recombinant Human Calcineurin Subunit B1/CNB1 (N-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, pH 8.0 . |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MGSSHHHHHHSSGLVPRGSHMGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV |
Source: E.coli.
MW :21.46kD.
Recombinant Human Calcineurin Subunit B1 is produced by our E.coli expression system and the target gene encoding Met1-Val170 is expressed with a 6His tag at the N-terminus. Calcineurin Subunit B Type 1 belongs to the calcineurin regulatory subunit family. Calcineurin Subunit B Type 1 is a Ser/Thr-specific calcium and calmodulin-dependent protein phosphatase. It is composed of a catalytic subunit (A) and a regulatory subunit (B). It contains four EF-hand domains and four functional calcium-binding sites. Calcineurin Subunit B Type 1 plays an improtant role in the T cell activation pathway.
MW :21.46kD.
Recombinant Human Calcineurin Subunit B1 is produced by our E.coli expression system and the target gene encoding Met1-Val170 is expressed with a 6His tag at the N-terminus. Calcineurin Subunit B Type 1 belongs to the calcineurin regulatory subunit family. Calcineurin Subunit B Type 1 is a Ser/Thr-specific calcium and calmodulin-dependent protein phosphatase. It is composed of a catalytic subunit (A) and a regulatory subunit (B). It contains four EF-hand domains and four functional calcium-binding sites. Calcineurin Subunit B Type 1 plays an improtant role in the T cell activation pathway.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Cell membrane, Cell membrane, Membrane |
| BioGrid: | 111526. 40 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
