Recombinant Human C1QBP/HABP1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM Tris, 20% Glycerol, 1mM DTT, pH 7.5. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQLEHHHHHH |
Source: E. coli.
MW :24.9kD.
Recombinant Human Hyaluronic Acid-binding Protein is produced by our E.coli expression system and the target gene encoding Leu74-Gln282 is expressed with a 6His tag at the C-terminus. Complement Component 1Q Subcomponent-Binding Protein (C1QBP) is a nucleus protein that belongs to the MAM33 family. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. Mitochondrial C1QBP is a critical mediator of p14ARF-induced apoptosis. C1QBP functions as a chemotactic factor for immature dendritic cells, and migration is mediated through ligation of both C1QBP and cC1qR/CR. C1QBP overexpression successfully blocks mRNA accumulation from the adenovirus major late transcription unit (MLTU) and stimulates RNA polymerase II carboxy-terminal domain phosphorylation in virus-infected cells.
MW :24.9kD.
Recombinant Human Hyaluronic Acid-binding Protein is produced by our E.coli expression system and the target gene encoding Leu74-Gln282 is expressed with a 6His tag at the C-terminus. Complement Component 1Q Subcomponent-Binding Protein (C1QBP) is a nucleus protein that belongs to the MAM33 family. C1QBP is known to bind to the globular heads of C1q molecules and inhibit C1 activation. Mitochondrial C1QBP is a critical mediator of p14ARF-induced apoptosis. C1QBP functions as a chemotactic factor for immature dendritic cells, and migration is mediated through ligation of both C1QBP and cC1qR/CR. C1QBP overexpression successfully blocks mRNA accumulation from the adenovirus major late transcription unit (MLTU) and stimulates RNA polymerase II carboxy-terminal domain phosphorylation in virus-infected cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Mitochondrion matrix, Nucleus, Cell membrane, Secreted, Cytoplasm, Nucleus |
| Tissue Specificity: | Expressed on cell surface of peripheral blood cells (at protein level); Surface expression is reported for macrophages and monocyte-derived dendritic cells. |
| BioGrid: | 107169. 254 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
