Recombinant Human C-X-C Motif Chemokine 14/CXCL14
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM TrisHCl, 1M NaCl, pH 8.5. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE |
Source: E.coli.
MW :9.4kD.
Recombinant Human C-X-C Motif Chemokine 14 is produced by our E.coli expression system and the target gene encoding Ser35-Glu111 is expressed. Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues.
MW :9.4kD.
Recombinant Human C-X-C Motif Chemokine 14 is produced by our E.coli expression system and the target gene encoding Ser35-Glu111 is expressed. Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Biological Activity : ED50 is 1.0-10.0 ng/ml.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | Ubiquitinated, followed by degradation by the proteasome. |
| Tissue Specificity: | Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes. |
| BioGrid: | 114921. 4 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
