Recombinant Human C-X-C Motif Chemokine 10/CXCL10
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.0. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Source: E.coli.
MW :8.6kD.
Recombinant Human C-X-C Motif Chemokine 10 is produced by our E.coli expression system and the target gene encoding Val22-Pro98 is expressed. Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types, such as monocytes, endothelial cells and fibroblasts, in response to IFN-gamma. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles, such as chemoattraction for activated T-lymphocytes, inhibition of angiogenesis, and antitumor activity.
MW :8.6kD.
Recombinant Human C-X-C Motif Chemokine 10 is produced by our E.coli expression system and the target gene encoding Val22-Pro98 is expressed. Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types, such as monocytes, endothelial cells and fibroblasts, in response to IFN-gamma. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles, such as chemoattraction for activated T-lymphocytes, inhibition of angiogenesis, and antitumor activity.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Biological Activity : ED50 is 0.02-0.06 ?g/mL.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | CXCL10(1-73) is produced by proteolytic cleavage after secretion from keratinocytes. |
| BioGrid: | 109839. 2 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
