Recombinant Human C-C Motif Chemokine 8/CCL8/MCP-2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,1mM EDTA, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTQRGKEVCADPKERWVRDSMKHLDQIFQNLKPVDHHHHHH |
Source: Human Cells.
MW :9.95kD.
Recombinant Human C-C Motif Chemokine 8 is produced by our Mammalian expression system and the target gene encoding Gln24-Pro99 is expressed with a 6His tag at the C-terminus. Human Chemokine (C-C Motif) Ligand 8 (CCL8) is produced by human MG63 osteosarcoma cells. CCL8 shares 62% and 58% amino acid sequence identity with MCP-1 and MCP-3, respectively. All three MCP proteins are monocyte chemoattractants. CCL8 is chemotactic for and activates many different immune cells, including mast cells, eosinophils and basophils, which are implicated in allergic response, and monocytes, T cells, and NK cells that are involved in the inflammatory response. CCL8 elicits its effects by binding to several different cell surface receptors including CCR1, CCR2B and CCR5.
MW :9.95kD.
Recombinant Human C-C Motif Chemokine 8 is produced by our Mammalian expression system and the target gene encoding Gln24-Pro99 is expressed with a 6His tag at the C-terminus. Human Chemokine (C-C Motif) Ligand 8 (CCL8) is produced by human MG63 osteosarcoma cells. CCL8 shares 62% and 58% amino acid sequence identity with MCP-1 and MCP-3, respectively. All three MCP proteins are monocyte chemoattractants. CCL8 is chemotactic for and activates many different immune cells, including mast cells, eosinophils and basophils, which are implicated in allergic response, and monocytes, T cells, and NK cells that are involved in the inflammatory response. CCL8 elicits its effects by binding to several different cell surface receptors including CCR1, CCR2B and CCR5.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Secreted |
| Post transnational modification: | N-terminal processed form MCP-2(6-76) is produced by proteolytic cleavage after secretion from peripheral blood monocytes. |
| Tissue Specificity: | Highest expression found in the small intestine and peripheral blood cells. Intermediate levels seen in the heart, placenta, lung, skeletal muscle, thymus, colon, ovary, spinal cord and pancreas. Low levels seen in the brain, liver, spleen and prostate. |
| BioGrid: | 112258. 2 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
