Recombinant Human C-C Motif Chemokine 24/CCL24/Eotaxin-2/MPIF-2 (C-6His)(Discontinued)
![](images/categories/discont_prod_icon.jpg)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.2. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTCVDHHHHHH |
Source: Human Cells.
MW :11.5kD.
Recombinant Human C-C Motif Chemokine 24 is produced by our Mammalian expression system and the target gene encoding Val27-Cys119 is expressed with a 6His tag at the C-terminus. Cytokine are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteine. CCL24 diaplays the chemotactic for resting T-lymphocytes and eosinophils. CCL24 has lower chemotatic activity for neutrophils, none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell lines.
MW :11.5kD.
Recombinant Human C-C Motif Chemokine 24 is produced by our Mammalian expression system and the target gene encoding Val27-Cys119 is expressed with a 6His tag at the C-terminus. Cytokine are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteine. CCL24 diaplays the chemotactic for resting T-lymphocytes and eosinophils. CCL24 has lower chemotatic activity for neutrophils, none for monocytes and activated lymphocytes. CCL24 is a strong suppressor of colony formation by a multipotential hematopoietic progenitor cell lines.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Secreted |
Post transnational modification: | N-glycosylated. |
Tissue Specificity: | Activated monocytes and activated T lymphocytes. |
There are currently no product reviews
|