Recombinant Human Butyrophilin Subfamily 3 Member A1/BTN3A1/CD277 (C-Fc)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Source: Human Cells.
MW :50.8kD.
Recombinant Human Butyrophilin Subfamily 3 Member A1 is produced by our Mammalian expression system and the target gene encoding Gln30-Gly254 is expressed with a Fc tag at the C-terminus. Butyrophilin Subfamily 3 Member A1 (BTN3A1/CD277) is a type I transmembrane glycoprotein member of the Ig superfamily. It is expressed on a wide variety of immune cells. Similar to BTN3A2 and BTN3A3, BTN3A1 is composed of an extracellular N-terminal IgV and a membraneproximal IgC domain followed by a transmembrane domain and a cytoplasmic tail. These Ig domains are also found in B7 family costimulatory molecules, suggesting structural and functional similarities between the two protein families. BTN3A1 acts as a critical protein for the activation of V gamma 9V delta 2 T cells following detection of distressed cells. The anti-tumor responses of V gamma 9V delta 2 T cells may be enhanced with agonistic anti-BTNA3 antibodies.
MW :50.8kD.
Recombinant Human Butyrophilin Subfamily 3 Member A1 is produced by our Mammalian expression system and the target gene encoding Gln30-Gly254 is expressed with a Fc tag at the C-terminus. Butyrophilin Subfamily 3 Member A1 (BTN3A1/CD277) is a type I transmembrane glycoprotein member of the Ig superfamily. It is expressed on a wide variety of immune cells. Similar to BTN3A2 and BTN3A3, BTN3A1 is composed of an extracellular N-terminal IgV and a membraneproximal IgC domain followed by a transmembrane domain and a cytoplasmic tail. These Ig domains are also found in B7 family costimulatory molecules, suggesting structural and functional similarities between the two protein families. BTN3A1 acts as a critical protein for the activation of V gamma 9V delta 2 T cells following detection of distressed cells. The anti-tumor responses of V gamma 9V delta 2 T cells may be enhanced with agonistic anti-BTNA3 antibodies.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Detected on T-cells, natural killer cells, dendritic cells and macrophages (at protein level). Ubiquitous. Highly expressed in heart, pancreas and lung, Moderately expressed in placenta, liver and muscle. |
| BioGrid: | 116294. 14 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
