Recombinant Human Butyrophilin 3A3/BTN3A3 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB,150mM NaCl,pH7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELRWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHIEVKGYEDGGIHLECRSTGWYPQPQIKWSDTKGENIPAVEAPVVADGVGLYAVAASVIMRGSSGGGVSCIIRNSLLGLEKTASISIADPFFRSAQPWVDHHHHHH |
Source: Human Cells.
MW :24.6kD.
Recombinant Human Butyrophilin 3A3 is produced by our Mammalian expression system and the target gene encoding Gln30-Trp248 is expressed with a 6His tag at the C-terminus. Human BTN3A3, also known as butyrophilin subfamily 3 member A3 and BTF3, is a Single-pass type I membrane protein which belongs to the immunoglobulin superfamily and BTN/MOG family. The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin domains and an intracellular B30.2 (PRYSPRY) domain. It can be detected in peripheral blood mononuclear cells, T-cells l, spleen and lymphocytes. BTN3A3 plays a role in T-cell responses in the adaptive immune response.
MW :24.6kD.
Recombinant Human Butyrophilin 3A3 is produced by our Mammalian expression system and the target gene encoding Gln30-Trp248 is expressed with a 6His tag at the C-terminus. Human BTN3A3, also known as butyrophilin subfamily 3 member A3 and BTF3, is a Single-pass type I membrane protein which belongs to the immunoglobulin superfamily and BTN/MOG family. The butyrophilin (BTN) genes are a group of major histocompatibility complex (MHC)-associated genes that encode type I membrane proteins with 2 extracellular immunoglobulin domains and an intracellular B30.2 (PRYSPRY) domain. It can be detected in peripheral blood mononuclear cells, T-cells l, spleen and lymphocytes. BTN3A3 plays a role in T-cell responses in the adaptive immune response.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Post transnational modification: | N-glycosylated. |
| Tissue Specificity: | Detected in peripheral blood mononuclear cells and in T-cells (at protein level). Detected in spleen and lymphocytes. |
| BioGrid: | 115657. 9 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
