Recombinant Human BMP Receptor II/BMPR2/PPH1 (C-6His)(Discontinued)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIVDHHHHHH |
Source: Human Cells.
MW :15.05kD.
Recombinant Human BMP Receptor II is produced by our Mammalian expression system and the target gene encoding Ser27-Ile151 is expressed with a 6His tag at the C-terminus. Bone Morphogenetic Protein Receptor II (BMPR-II) is a Type II Serine/Threonine Kinase that mediates cellular responses to BMPs. BMPR-II is characterized by lacking of a GS domain, and presence of a C-terminal extension typical of type II receptors. BMPRII binds BMP2, BMP4 and BMP7 weakly in the absence of type I receptor, and the binding can be facilitated by the presence of the type I receptor, including BMPR-IA/Brk1, BMPR-IB, and ActR-I. BMPR-II plays a key role in cell growth. Defects in BMPR-II have been linked to primary pulmonary hypertension. Human and mouse BMPR-II are highly conserved and share 97 % amino acid sequence identity.
MW :15.05kD.
Recombinant Human BMP Receptor II is produced by our Mammalian expression system and the target gene encoding Ser27-Ile151 is expressed with a 6His tag at the C-terminus. Bone Morphogenetic Protein Receptor II (BMPR-II) is a Type II Serine/Threonine Kinase that mediates cellular responses to BMPs. BMPR-II is characterized by lacking of a GS domain, and presence of a C-terminal extension typical of type II receptors. BMPRII binds BMP2, BMP4 and BMP7 weakly in the absence of type I receptor, and the binding can be facilitated by the presence of the type I receptor, including BMPR-IA/Brk1, BMPR-IB, and ActR-I. BMPR-II plays a key role in cell growth. Defects in BMPR-II have been linked to primary pulmonary hypertension. Human and mouse BMPR-II are highly conserved and share 97 % amino acid sequence identity.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cell membrane |
| Tissue Specificity: | Highly expressed in heart and liver. |
| BioGrid: | 107127. 57 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
