Recombinant Human BMP and Activin Membrane-Bound Inhibitor Homolog/BAMBI (C-6His)(Discontinued)
![](images/categories/discont_prod_icon.jpg)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | VLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWFRAVDHHHHHH |
Source: Human Cells.
MW :15.57kD.
Recombinant Human BAMBI is produced by our Mammalian expression system and the target gene encoding Val21-Ala152 is expressed with a 6His tag at the C-terminus. BMP and Activin Membrane-Bound Inhibitor Homolog (BAMBI) is a single-pass type I membrane protein that belongs to the BAMBI family. BAMBI is highly expression in kidney medulla, placenta and spleen. BAMBI is induced by BMP signaling through the evolutionary conserved BMP-responsive elements in its promoter. BAMBI plays important roles in signal transduction in many developmental and pathological processes. BAMBI transcription is activated by Wnt/beta-catenin signaling then its expression is aberrantly elevated in most colorectal carcinomas. BAMBI stably associates with TGF- beta-family receptors and inhibits BMP and activin as well as TGF- beta signalling. BAMBI negatively regulates TGF- beta-family signalling by a regulatory mechanism involving the interaction of signalling receptors with a pseudoreceptor.
MW :15.57kD.
Recombinant Human BAMBI is produced by our Mammalian expression system and the target gene encoding Val21-Ala152 is expressed with a 6His tag at the C-terminus. BMP and Activin Membrane-Bound Inhibitor Homolog (BAMBI) is a single-pass type I membrane protein that belongs to the BAMBI family. BAMBI is highly expression in kidney medulla, placenta and spleen. BAMBI is induced by BMP signaling through the evolutionary conserved BMP-responsive elements in its promoter. BAMBI plays important roles in signal transduction in many developmental and pathological processes. BAMBI transcription is activated by Wnt/beta-catenin signaling then its expression is aberrantly elevated in most colorectal carcinomas. BAMBI stably associates with TGF- beta-family receptors and inhibits BMP and activin as well as TGF- beta signalling. BAMBI negatively regulates TGF- beta-family signalling by a regulatory mechanism involving the interaction of signalling receptors with a pseudoreceptor.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Membrane |
Tissue Specificity: | High expression in kidney medulla, placenta and spleen; low in kidney cortex, liver, prostate and gut. Not expressed in normal skin, expression is high in melanocytes and in 3 out of 11 melanoma metastases tested. |
BioGrid: | 117337. 10 interactions. |
There are currently no product reviews
|