Recombinant Human Bcl-2 Related Protein A1/BCL2A1 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSLEHHHHHH |
Source: E.coli.
MW :18.52kD.
Recombinant Human Bcl-2 Related Protein A1 is produced by our E.coli expression system and the target gene encoding Met1-Ser152 is expressed with a 6His tag at the C-terminus. Bcl-2-Related Protein A1 (BCL2A1) is a member of of the BCL-2 protein family which act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. BCL2A1 is a cytoplasm protein and interacts directly with BAK1, BID, BMF and BBC3. BCL2A1 is induced by phorbol ester and inflammatory cytokines, such as TNF or IL1B/interleukin-1 beta, but not by growth factors. BCL2A1 is invovled in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection.
MW :18.52kD.
Recombinant Human Bcl-2 Related Protein A1 is produced by our E.coli expression system and the target gene encoding Met1-Ser152 is expressed with a 6His tag at the C-terminus. Bcl-2-Related Protein A1 (BCL2A1) is a member of of the BCL-2 protein family which act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. BCL2A1 is a cytoplasm protein and interacts directly with BAK1, BID, BMF and BBC3. BCL2A1 is induced by phorbol ester and inflammatory cytokines, such as TNF or IL1B/interleukin-1 beta, but not by growth factors. BCL2A1 is invovled in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| Tissue Specificity: | Seems to be restricted to the hematopoietic compartment. Expressed in peripheral blood, spleen, and bone marrow, at moderate levels in lung, small intestine and testis, at a minimal levels in other tissues. Also found in vascular smooth muscle cells and hematopoietic malignancies. |
| BioGrid: | 107069. 16 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
