Recombinant Human B7-H2/ICOSLG/CD275 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
AA sequence : | DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSVDHHHHHH |
Source: Human Cells.
MW :27.72kD.
Recombinant Human Inducible Co-Stimulator Ligand is produced by our Mammalian expression system and the target gene encoding Asp19-Ser258 is expressed with a 6His tag at the C-terminus. Inducible Co-Stimulator Ligand (ICOSLG) belongs to the immunoglobulin superfamily. ICOSLG contains Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. ICOSLG acts as a costimulatory signal for T-cell proliferation and cytokine secretion, it also induces B-cell proliferation and differentiation into plasma cells. It could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. ICOSLG is widely expressed lymph nodes, leukocytes and spleen, detected on activated monocytes and dendritic cells.
MW :27.72kD.
Recombinant Human Inducible Co-Stimulator Ligand is produced by our Mammalian expression system and the target gene encoding Asp19-Ser258 is expressed with a 6His tag at the C-terminus. Inducible Co-Stimulator Ligand (ICOSLG) belongs to the immunoglobulin superfamily. ICOSLG contains Ig-like C2-type (immunoglobulin-like) domain and 1 Ig-like V-type (immunoglobulin-like) domain. ICOSLG acts as a costimulatory signal for T-cell proliferation and cytokine secretion, it also induces B-cell proliferation and differentiation into plasma cells. It could play an important role in mediating local tissue responses to inflammatory conditions, as well as in modulating the secondary immune response by co-stimulating memory T-cell function. ICOSLG is widely expressed lymph nodes, leukocytes and spleen, detected on activated monocytes and dendritic cells.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Cell membrane |
Tissue Specificity: | Isoform 1 is widely expressed (brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, bone marrow, colon, ovary, prostate, testis, lymph nodes, leukocytes, spleen, thymus and tonsil), while isoform 2 is detected only in lymph nodes, leukocytes and spleen. Expressed on activated monocytes and dendritic cells. |
BioGrid: | 116900. 8 interactions. |
There are currently no product reviews
|