Recombinant Human B7-1/CD80 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of PBS, pH 7.4. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNHHHHHH |
Source: Human Cells.
MW :24.7kD.
Recombinant Human Activation B7-1 antigen is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus. Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. It is the ligand for two different proteins on the T cell surface: CD28 and CTLA-4. Studies have shown that CTLA-4 binds mostly to CD80. The structure presents two extracellular domains: a membrane distal variable-like domain (IgV) and a membrane proximal Ig constant-like domain (IgC) along with an intracellular domain. Both IgV and IgC consist of anti-parallel beta sandwiches joined by a short linker region. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.
MW :24.7kD.
Recombinant Human Activation B7-1 antigen is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus. Cluster of Differentiation 80, also called B7-1, is a member of cell surface immunoglobulin superfamily which plays key, yet distinct roles in the activation of T cells. It is the ligand for two different proteins on the T cell surface: CD28 and CTLA-4. Studies have shown that CTLA-4 binds mostly to CD80. The structure presents two extracellular domains: a membrane distal variable-like domain (IgV) and a membrane proximal Ig constant-like domain (IgC) along with an intracellular domain. Both IgV and IgC consist of anti-parallel beta sandwiches joined by a short linker region. CD80 is mostly expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Membrane |
| Tissue Specificity: | Expressed on activated B-cells, macrophages and dendritic cells. |
| BioGrid: | 107379. 75 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
