Recombinant Human B-Cell Linker Protein/BLNK (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Lyophilized from a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, 1mM DTT, pH 7.2. |
| Storage condition : | Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months. |
| AA sequence : | MDKLNKITVPASQKLRQLQKMVHDIKNNEGGIMNKIKKLKVKAPPSVPRRDYASESPADEEQQWSDDFDSDYENPDEHSDSEMYVMPAEENADDSYEPPPVEQETRPVHPALPFARGEYIDNRSSQRHSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSSTPASPPGTASGRNSGAWETKSPPPAAPSPLPRAGKKPTTPLKTTPVASQQNASSVCEEKPIPAERHRGSSHRQEAVQSPVFPPAQKQIHQKPIPLPRFTEGGNPTVDGPLPSFSSNSTISEQEAGVLCKPWYAGACDRKSAEEALHRSNKDGSFLIRKSSGHDSKQPYTLVVFFNKRVYNIPVRFIEATKQYALGRKKNGEEYFGSVAEIIRNHQHSPLVLIDSQNNTKDSTRLKYAVKVSLEHHHHHH |
Source: E.coli.
MW :51.5kD.
Recombinant Human B-Cell Linker Protein is produced by our E.coli expression system and the target gene encoding Met1-Ser456 is expressed with a 6His tag at the C-terminus. B-Cell Linker Protein (BLNK) is a cell membrane protein which contains 1 SH2 domain. BLNK is expressed in B cells and fibroblast cell lines, playing a important role in B cell receptor signaling. BLNK as a central linker protein, downstream of the B-cell receptor (BCR), bridges the SYK kinase to a multitude of signaling pathways and regulating biological outcomes of B-cell function and development. BLNK associates with the activation of ERK/EPHB2, MAP kinase p38 and JNK, modulates AP1, NF-kappa-B and NFAT activation. BLNK involves in BCR-mediated PLCG1 and PLCG2 activation and Ca2+ mobilization and is required for trafficking of the BCR to late endosomes. BLNK deficiency results in agammaglobulinemia type 4 and much more profound block in B-cell development.
MW :51.5kD.
Recombinant Human B-Cell Linker Protein is produced by our E.coli expression system and the target gene encoding Met1-Ser456 is expressed with a 6His tag at the C-terminus. B-Cell Linker Protein (BLNK) is a cell membrane protein which contains 1 SH2 domain. BLNK is expressed in B cells and fibroblast cell lines, playing a important role in B cell receptor signaling. BLNK as a central linker protein, downstream of the B-cell receptor (BCR), bridges the SYK kinase to a multitude of signaling pathways and regulating biological outcomes of B-cell function and development. BLNK associates with the activation of ERK/EPHB2, MAP kinase p38 and JNK, modulates AP1, NF-kappa-B and NFAT activation. BLNK involves in BCR-mediated PLCG1 and PLCG2 activation and Ca2+ mobilization and is required for trafficking of the BCR to late endosomes. BLNK deficiency results in agammaglobulinemia type 4 and much more profound block in B-cell development.
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm, Cell membrane |
| Post transnational modification: | Following BCR activation, phosphorylated on tyrosine residues by SYK and LYN. When phosphorylated, serves as a scaffold to assemble downstream targets of antigen activation, including PLCG1, VAV1, GRB2 and NCK1. Phosphorylation of Tyr-84, Tyr-178 and Tyr-189 facilitates PLCG1 binding. Phosphorylation of Tyr-96 facilitates BTK binding. Phosphorylation of Tyr-72 facilitates VAV1 and NCK1 binding. Phosphorylation is required for both Ca(2+) and MAPK signaling pathways. |
| Tissue Specificity: | Expressed in B-cell lineage and fibroblast cell lines (at protein level). Highest levels of expression in the spleen, with lower levels in the liver, kidney, pancreas, small intestines and colon. |
| BioGrid: | 118894. 33 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
