Recombinant Human Autophagy Related 10 Homolog/ATG10 (C-6His, N-T7 tag)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
| Amount : | 50 µg |
| Content : | Supplied as a 0.2 µm filtered solution of 20mM PB, 150mM NaCl, pH 8.0. |
| Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
| AA sequence : | MASMTGGQQMGRGSMEEDEFIGEKTFQRYCAEFIKHSQQIGDSWEWRPSKDCSDGYMCKIHFQIKNGSVMSHLGASTHGQTCLPMEEAFELPLDDCEVIETAAASEVIKYEYHVLYSCSYQVPVLYFRASFLDGRPLTLKDIWEGVHECYKMRLLQGPWDTITQQEHPILGQPFFVLHPCKTNEFMTPVLKNSQKINKNVNYITLEHHHHHH |
Source: E.coli.
MW :24.5kD.
Recombinant Human Autophagy protein 10 is produced by our E.coli expression system and the target gene encoding Met1-Thr190 is expressed with a T7 tag at the N-terminus, 6His tag at the C-terminus. Ubiquitin-Like-Conjugating Enzyme ATG10 (ATG10) is a ubiquitous 28kDa member of the ATG10 family protein. ATG10 acts as an E2-like enzyme, catalyzes the transfer of ATG12 to ATG5 during in the initial stages of autophagesome formation. The heterodimer of ATG5 and ATG12 subsequntly associates non-covalently with an ATG16 multimer to generate an antophagosome. ATG10 plays a role in the conjugation of ATG12 to ATG5 by interaction with MAP1LC3A. In addition, ATG10 can diretly interact with ATG5 or ATG7.
MW :24.5kD.
Recombinant Human Autophagy protein 10 is produced by our E.coli expression system and the target gene encoding Met1-Thr190 is expressed with a T7 tag at the N-terminus, 6His tag at the C-terminus. Ubiquitin-Like-Conjugating Enzyme ATG10 (ATG10) is a ubiquitous 28kDa member of the ATG10 family protein. ATG10 acts as an E2-like enzyme, catalyzes the transfer of ATG12 to ATG5 during in the initial stages of autophagesome formation. The heterodimer of ATG5 and ATG12 subsequntly associates non-covalently with an ATG16 multimer to generate an antophagosome. ATG10 plays a role in the conjugation of ATG12 to ATG5 by interaction with MAP1LC3A. In addition, ATG10 can diretly interact with ATG5 or ATG7.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
| Subcellular location: | Cytoplasm |
| BioGrid: | 123745. 11 interactions. |
|
There are currently no product reviews
|
.png "ACE2/HEK293 Stable Cell Line")
