Recombinant Human Arginase-2/ARG2 (C-6His)
Shipping Info:
For estimated delivery dates, please contact us at [email protected]
Amount : | 50 µg |
Content : | Supplied as a 0.2 µm filtered solution of 10mM TrisHCl,10mM NaCl,1mM beta-mercaptoethanol,pH7.5. |
Storage condition : | Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
AA sequence : | MHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHHHHHH |
Source: E.coli.
MW :34.2kD.
Recombinant Human Arginase-2, mitochondrial is produced by our E.coli expression system and the target gene encoding His24-Gly330 is expressed with a 6His tag at the C-terminus. Arginase-2 (ARG2) is a member of the arginase family. Arginase is a manganese-containing enzyme which catalyzes the hydrolysis of arginine to ornithine and urea. ARG2 is highly expressed in kidney and prostate, not founded in the liver, heart and pancreas. ARG2 has been implicated in the regulation of the arginine/ornithine concentrations in the cell. ARG2 may take part in the regulation of extra-urea cycle arginine metabolism and in down-regulation of nitric oxide synthesis. The extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase.
MW :34.2kD.
Recombinant Human Arginase-2, mitochondrial is produced by our E.coli expression system and the target gene encoding His24-Gly330 is expressed with a 6His tag at the C-terminus. Arginase-2 (ARG2) is a member of the arginase family. Arginase is a manganese-containing enzyme which catalyzes the hydrolysis of arginine to ornithine and urea. ARG2 is highly expressed in kidney and prostate, not founded in the liver, heart and pancreas. ARG2 has been implicated in the regulation of the arginine/ornithine concentrations in the cell. ARG2 may take part in the regulation of extra-urea cycle arginine metabolism and in down-regulation of nitric oxide synthesis. The extrahepatic arginase functions to regulate L-arginine bioavailability to NO synthase.
Endotoxin : Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
For Research Use Only. Not for use in diagnostic/therapeutics procedures.
Subcellular location: | Mitochondrion |
Tissue Specificity: | Expressed most strongly in kidney and prostate, much less strongly in the brain, skeletal muscle, placenta, lung, mammary gland, macrophage, uterus, testis and gut, but apparently not in the liver, heart and pancreas. Expressed in activated T cells (PubMed:27745970). |
BioGrid: | 106879. 6 interactions. |
There are currently no product reviews
|